Team:Carnegie Mellon/Met-Overview
From 2012.igem.org
The design of coupled RNA and protein fluorescent biosensors
Our synthetic reporters consist of a Spinach RNA reporter and a FAP (known as Ben) protein reporter. By placing a promoter of interest immediately upstream of Spinach, we can measure a fluorescence signal from mRNA that is transcribed from the promoter. To measure protein expression levels, we placed a RBS and a FAP at 14 base-pairs downstream of the Spinach sequence to avoid a steric clash between the Spinach RNA secondary structure and the ribosome. This way, we can measure the expression levels of both RNA and proteins in each cell over time. Our modular construct allows the plug-and-play of different promoters, hence allowing tremendous flexibility in the characterization of any promoters. This coupled system has several advantages over a traditional system that measures protein levels through fluorescent molecules such as green fluorescent proteins (GFP), CFP, and YFP. Our reporters differ significantly from the classical fluorescent proteins in that they only fluoresce upon the binding of specific dyes (malachite green for the FAP reporter and DFHBI for the Spinach reporter). This construct allows us to characterize more properties of any given promoter and address differences in RNA and protein expression dynamics. The plasmid map is shown here.
A simplified version of our construct is shown here.
Design of fluorescence spectra and measurements
To measure both RNA and protein levels simultaneously in a single cell, we need to design the fluorescence spectra such as the emission spectra do not overlap significantly. Therefore, we have chosen to use a FAP with Ex/Em=635/660. This FAP has a far-red emmision spectra that would be well-separated from any green fluorescent probes. For RNA measurements, we used a Spinach with Ex/Em=469/501. As shown by the following fluorescence spectra, the emmission spectra of both FAP and Spinach do not overlap.
L5 FAP (MG) Excitation and Emission Spectra
Spinach (DFHBI) Excitation and Emission Spectra
In our experiments, fluorescence intensities were measured using a Tecan SafireII at their maximum excitation and emission peaks with a 10nm bandwidth and optimal gain (100 for Spinach and 255 for the FAP).
Sequences of the Spinach RNA reporter and the FAP protein reporter
The coding sequence of the Spinach RNA reporter is as follows1:GCCCGGATAGCTCAGTCGGTAGAGCAGCGGCCGAGTAATTTACGTCGACGACGCAACCGAATGAAATGGTGAAG
GACGGGTCCAGGTGTGGCTGCTTCGGCAGTGCAGCTTGTTGAGTAGAGTGTGAGCTCCGTAACTGGTCGCGTCG
ACGTCGATGGTTGCGGCCGCGGGTCCAGGGTTCAAGTCCCTGTTCGGGCGCCA
The coding sequence of the FAP protein reporter is as follows2:
QAVVTQEPSVTVSPGGTVILTCGSSTGACTSGHYANWFQQKPGQAPRALIFETDKKYSWTPGRFSGSLLGAKAA
LTISDAQPEDEAEYYCSLSDVDGYLFGGGTQLTVLS
In our experiments, we used an improved version of the original L5 FAP that was published in Nature Biotechnology in 2008. The engineered version binds malachite green faster than L5 FAP. Due to unresolved issues of intellectual property, we could not deposit these reporters in the parts registry. However, we can share the parts upon formal requests by other labs.
1RNA Mimics of Green Fluorescent Protein. Jeremy S. Paige, Karen Y. Wu, and Samie R. Jaffrey, et al.
Science 29 July 2011: 333 (6042), 642-646. [DOI:10.1126/science.1207339]
2Shruti S, Urban-Ciecko J, Fitzpatrick JA, Brenner R, Bruchez MP, et al. (2012) The Brain-Specific Beta4 Subunit Downregulates BK Channel Cell Surface Expression. PLoS ONE 7(3): e33429. doi:10.1371/journal.pone.0033429