"
Team:Carnegie Mellon/Met-Overview
From 2012.igem.org
Enpederson (Talk | contribs) |
Enpederson (Talk | contribs) |
||
| Line 134: | Line 134: | ||
<h1>Fluorescence Readings</h1> | <h1>Fluorescence Readings</h1> | ||
<p> | <p> | ||
| - | In our experiments, fluorescence intensities were measured with a Tecan SafireII | + | In our experiments, fluorescence intensities were measured with a Tecan SafireII at their maximum excitation and emission peaks with a 10nm bandwidth and optimal gain (100 for Spinach and 255 for the FAP). FAP Ex/Em=635/660 and Spinach Ex/Em=469/501. |
| + | |||
<br> | <br> | ||
<h3>L5 FAP (MG) Excitation and Emission Spectra</h3> | <h3>L5 FAP (MG) Excitation and Emission Spectra</h3> | ||
<img src="https://static.igem.org/mediawiki/2012/c/c9/L5_Excitation-Emission.jpg"><br> | <img src="https://static.igem.org/mediawiki/2012/c/c9/L5_Excitation-Emission.jpg"><br> | ||
<h3>Spinach (DFHBI) Excitation and Emission Spectra</h3> | <h3>Spinach (DFHBI) Excitation and Emission Spectra</h3> | ||
| - | <img src="https://static.igem.org/mediawiki/2012/7/7a/Spinach_Excitation-Emission.jpg", width="329"><br> | + | <img src="https://static.igem.org/mediawiki/2012/7/7a/Spinach_Excitation-Emission.jpg", width="329"><br></p> |
| + | <h1>Sequences</h1> | ||
| + | The Spinach sequence we used is as follows<sup>1</sup>: | ||
| + | <br><b>GCCCGGATAGCTCAGTCGGTAGAGCAGCGGCCGAGTAATTTACGTCGACGACGCAACCGAATGAAATGGTGAAG<br>GACGGGTCCAGGTGTGGCTGCTTCGGCAGTGCAGCTTGTTGAGTAGAGTGTGAGCTCCGTAACTGGTCGCGTCG<br>ACGTCGATGGTTGCGGCCGCGGGTCCAGGGTTCAAGTCCCTGTTCGGGCGCCA</b> | ||
| + | <br> | ||
| + | The L5 sequence is as follows<sup>2</sup>: | ||
| + | <br><b>QAVVTQEPSVTVSPGGTVILTCGSSTGACTSGHYANWFQQKPGQAPRALIFETDKKYSWTPGRFSGSLLGAKAA<br>LTISDAQPEDEAEYYCSLSDVDGYLFGGGTQLTVLS</b> | ||
| + | <br> | ||
| + | <br> | ||
| + | <br> | ||
| + | <p><font size="1"> | ||
| + | <sup>1</sup>RNA Mimics of Green Fluorescent Protein. Jeremy S. Paige, Karen Y. Wu, and Samie R. Jaffrey, et al. | ||
| + | Science 29 July 2011: 333 (6042), 642-646. [DOI:10.1126/science.1207339] | ||
| + | <br> | ||
| + | <sup>2</sup>Shruti S, Urban-Ciecko J, Fitzpatrick JA, Brenner R, Bruchez MP, et al. (2012) The Brain-Specific Beta4 Subunit Downregulates BK Channel Cell Surface Expression. PLoS ONE 7(3): e33429. doi:10.1371/journal.pone.0033429 </p> | ||
| + | </font> | ||
</html> | </html> | ||
{{:Team:Carnegie_Mellon/Templates/Footer}} | {{:Team:Carnegie_Mellon/Templates/Footer}} | ||
Revision as of 20:01, 1 October 2012
Concept
The idea for the basis of promoter characterization is that our FAP (known as Ben) is a conditionally fluorescent protein. Similarly, our construct, known as Spinach is also conditionally fluorescent, but the two fluorescent constructs are not promiscuous. By placing the promoter of interest immediately upstream of Spinach, we get a fluorescence signal from the mRNA that is transcribed. To record protein fluoresence signals, we placed a RBS 14 base pairs downstream of the Spinach sequence to avoid a steric clash between the Spinach supramolecular structure and the ribosome. After the RBS, we cloned in our FAP so we can record protein levels over time as well as the RNA levels. This coupled system has several advantages over a traditional system, which only measures protein levels. This allows us to characterize more properties of any given promoter and address unpredicted behavior. The plasmid map is shown here.
A simplified version of our construct is shown here.
Fluorescence Readings
In our experiments, fluorescence intensities were measured with a Tecan SafireII at their maximum excitation and emission peaks with a 10nm bandwidth and optimal gain (100 for Spinach and 255 for the FAP). FAP Ex/Em=635/660 and Spinach Ex/Em=469/501.
L5 FAP (MG) Excitation and Emission Spectra
Spinach (DFHBI) Excitation and Emission Spectra
Sequences
The Spinach sequence we used is as follows1:GCCCGGATAGCTCAGTCGGTAGAGCAGCGGCCGAGTAATTTACGTCGACGACGCAACCGAATGAAATGGTGAAG
GACGGGTCCAGGTGTGGCTGCTTCGGCAGTGCAGCTTGTTGAGTAGAGTGTGAGCTCCGTAACTGGTCGCGTCG
ACGTCGATGGTTGCGGCCGCGGGTCCAGGGTTCAAGTCCCTGTTCGGGCGCCA
The L5 sequence is as follows2:
QAVVTQEPSVTVSPGGTVILTCGSSTGACTSGHYANWFQQKPGQAPRALIFETDKKYSWTPGRFSGSLLGAKAA
LTISDAQPEDEAEYYCSLSDVDGYLFGGGTQLTVLS
1RNA Mimics of Green Fluorescent Protein. Jeremy S. Paige, Karen Y. Wu, and Samie R. Jaffrey, et al.
Science 29 July 2011: 333 (6042), 642-646. [DOI:10.1126/science.1207339]
2Shruti S, Urban-Ciecko J, Fitzpatrick JA, Brenner R, Bruchez MP, et al. (2012) The Brain-Specific Beta4 Subunit Downregulates BK Channel Cell Surface Expression. PLoS ONE 7(3): e33429. doi:10.1371/journal.pone.0033429
